PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT30398
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Dof
Protein Properties Length: 355aa    MW: 36588.8 Da    PI: 8.474
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT30398genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.95.4e-391776261
    zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
              +e++++cprC+s ntkfCyynnys+sqPryfCkaCrryWt+GG+lrnvP+Ggg+rk k+s
  EMT30398 17 PEQKVECPRCKSGNTKFCYYNNYSMSQPRYFCKACRRYWTHGGSLRNVPIGGGCRKPKRS 76
              7899*****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074788.0E-311575IPR003851Zinc finger, Dof-type
PfamPF027011.1E-321975IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.6492175IPR003851Zinc finger, Dof-type
PROSITE patternPS0136102359IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 355 aa     Download sequence    Send to blast
MAGEAIAGAE KKPRPKPEQK VECPRCKSGN TKFCYYNNYS MSQPRYFCKA CRRYWTHGGS  60
LRNVPIGGGC RKPKRSGTSD AHKLGVASSP EPTTVVPPST CTGMNFANVL PTFMSVGFEI  120
PSSLSLTAFG SSSSSNTAAM MSPGGTTSFL DVLRGGAGGL LDGSLSQNNG YYYGGPAIGS  180
GNGMLMTPPA ASFGIPVPMQ QHGDLVVGGN GIGAATASIF QGATSEEGDD GTGGVMGLQW  240
QPQVGNGGGG GGVSGGVHHL GTGNNVTMGN SNIHNNNNND SGGDDNNGGS SRDCYWINNG  300
GSNPWQSLLN SSSLMKFLGI VFRSSKGCFT SISSINMSLF GRDSLFQVGL KGVEN
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY4960570.0AY496057.2 Triticum aestivum Dof DNA-binding protein mRNA, complete cds.
GenBankKC8497010.0KC849701.1 Triticum aestivum cultivar Chinese Spring clone CSPBF01 zf-Dof domain protein (pbf) gene, complete cds.
GenBankKJ5447720.0KJ544772.1 Aegilops tauschii cultivar AS2386 prolamin binding factor gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLM8C8J40.0M8C8J4_AEGTA; Dof zinc finger protein PBF
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.12e-33TARGET OF MONOPTEROS 6